LRRTM3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2090879
Article Name: LRRTM3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2090879
Supplier Catalog Number: orb2090879
Alternative Catalog Number: BYT-ORB2090879-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human LRRTM3
Conjugation: HRP
Alternative Names: LRRTM3, UNQ803/PRO1693,
LRRTM3 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 56kDa
UniProt: Q86VH5
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: QLQQRSLMRRHRKKKRQSLKQMTPSTQEFYVDYKPTNTETSEMLLNGTGP