LGSN Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2090888
Article Name: LGSN Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2090888
Supplier Catalog Number: orb2090888
Alternative Catalog Number: BYT-ORB2090888-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human LGSN
Conjugation: HRP
Alternative Names: LGS, GLULD1
LGSN Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 057655
UniProt: Q5TDP6
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: QEDSTRDEGNETEANSMNTLRRTRKKVTKPYVCSTEVGETDMSNSNDCMR