KIR2DL3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2090892
Article Name: KIR2DL3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2090892
Supplier Catalog Number: orb2090892
Alternative Catalog Number: BYT-ORB2090892-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human KIR2DL3
Conjugation: FITC
Alternative Names: p58, NKAT, GL183, NKAT2, CD158b, KIR2DL, NKAT2A, NKAT2B, CD158B2, KIR-K7b, KIR-K7c, KIR2DS5, KIRCL23, KIR-023GB
KIR2DL3 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 26kDa
UniProt: P43628
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GTSVVIILFILLLFFLLHRWCCNKKNAVVMDQEPAGNRTVNREDSDEQDP