HPSE2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2090901
Article Name: HPSE2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2090901
Supplier Catalog Number: orb2090901
Alternative Catalog Number: BYT-ORB2090901-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human HPSE2
Conjugation: FITC
Alternative Names: UFS, HPA2, HPR2, UFS1
HPSE2 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 001159717
UniProt: Q8WWQ2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SPAFLRFGGKRTDFLQFQNLRNPAKSRGGPGPDYYLKNYEDEPNNYRTMH