FOLR2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2090904
Article Name: FOLR2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2090904
Supplier Catalog Number: orb2090904
Alternative Catalog Number: BYT-ORB2090904-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FOLR2
Conjugation: FITC
Alternative Names: FBP, FOLR1, FR-P3, FRbeta, FR-BETA, BETA-HFR, FBP/PL-1
FOLR2 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 31kDa
NCBI: 000794
UniProt: P14207
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVNA