EPYC Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2090906
Article Name: EPYC Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2090906
Supplier Catalog Number: orb2090906
Alternative Catalog Number: BYT-ORB2090906-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human EPYC
Conjugation: HRP
Alternative Names: PGLB, DSPG3, Pg-Lb, SLRR3B
EPYC Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 004941
UniProt: Q99645
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: FYSRFNRIKKINKNDFASLSDLKRIDLTSNLISEIDEDAFRKLPQLRELV