EPYC Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2090908
Article Name: EPYC Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2090908
Supplier Catalog Number: orb2090908
Alternative Catalog Number: BYT-ORB2090908-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human EPYC
Conjugation: Biotin
Alternative Names: PGLB, DSPG3, Pg-Lb, SLRR3B
EPYC Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 004941
UniProt: Q99645
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FYSRFNRIKKINKNDFASLSDLKRIDLTSNLISEIDEDAFRKLPQLRELV