CR1L Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2090921
Article Name: CR1L Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2090921
Supplier Catalog Number: orb2090921
Alternative Catalog Number: BYT-ORB2090921-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CR1L
Conjugation: HRP
Alternative Names: MGC129536
CR1L Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 59kDa
NCBI: 783641
UniProt: Q2VPA4
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: ALNKWEPELPSCSRVCQPPPDVLHAERTQRDKDNFSPGQEVFYSCEPGYD