Tmprss3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2090955
Article Name: Tmprss3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2090955
Supplier Catalog Number: orb2090955
Alternative Catalog Number: BYT-ORB2090955-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Tmprss3
Conjugation: FITC
Tmprss3 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 52kDa
NCBI: 001157248
UniProt: Q3TZ06
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ISPSMLCAGYLKGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVN