POLDIP2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Catalog Number:
BYT-ORB2090964
| Article Name: |
POLDIP2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2090964 |
| Supplier Catalog Number: |
orb2090964 |
| Alternative Catalog Number: |
BYT-ORB2090964-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human POLDIP2 |
| Conjugation: |
FITC |
| Alternative Names: |
p38, POLD4, PDIP38 |
| POLDIP2 Rabbit Polyclonal Antibody (FITC) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
42kDa |
| NCBI: |
056399 |
| UniProt: |
Q9Y2S7 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: SSHVSLQASSGHMWGTFRFERPDGSHFDVRIPPFSLESNKDEKTPPSGLH |
