OTOP1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2090976
Article Name: OTOP1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2090976
Supplier Catalog Number: orb2090976
Alternative Catalog Number: BYT-ORB2090976-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OTOP1
Conjugation: FITC
Alternative Names: MGC163302, MGC163304
OTOP1 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 67kDa
NCBI: 819056
UniProt: Q7RTM1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KTKSESALIMFYLYAITLLMLMGAAGLAGIRIYRIDEKSLDESKNPARKL