MRPL12 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2090979
Article Name: MRPL12 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2090979
Supplier Catalog Number: orb2090979
Alternative Catalog Number: BYT-ORB2090979-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MRPL12
Conjugation: FITC
Alternative Names: 5c5-2, L12mt, MRPL7, RPML12, MRPL7/L12, MRP-L31/34
MRPL12 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 21kDa
NCBI: 002940
UniProt: P52815
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KKTLKIQDVGLVPMGGVMSGAVPAAAAQEAVEEDIPIAKERTHFTVRLTE