Mrpl12 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2090981
Article Name: Mrpl12 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2090981
Supplier Catalog Number: orb2090981
Alternative Catalog Number: BYT-ORB2090981-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Mrpl12
Conjugation: HRP
Alternative Names: Rpm12
Mrpl12 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 001025071
UniProt: D3ZXF9
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: RRSEALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLKI