ADGRL1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2090993
Article Name: ADGRL1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2090993
Supplier Catalog Number: orb2090993
Alternative Catalog Number: BYT-ORB2090993-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human LPHN1
Conjugation: HRP
Alternative Names: CL1, LEC2, CIRL1, LPHN1
ADGRL1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 95kDa
NCBI: 07587
UniProt: O94910
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: YSLRSGDFPPGDGGPEPPRGRNLADAAAFEKMIISELVHNNLRGSSSAAK