ADGRL1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2090994
Article Name: ADGRL1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2090994
Supplier Catalog Number: orb2090994
Alternative Catalog Number: BYT-ORB2090994-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human LPHN1
Conjugation: FITC
Alternative Names: CL1, LEC2, CIRL1, LPHN1
ADGRL1 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 95kDa
NCBI: 07587
UniProt: O94910
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: YSLRSGDFPPGDGGPEPPRGRNLADAAAFEKMIISELVHNNLRGSSSAAK