LIMS2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2090997
Article Name: LIMS2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2090997
Supplier Catalog Number: orb2090997
Alternative Catalog Number: BYT-ORB2090997-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human LIMS2
Conjugation: FITC
Alternative Names: LGMD2W, PINCH2, MDRCMTT, PINCH-2
LIMS2 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 001154876
UniProt: Q7Z4I7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DVELADLGFVKNAGRHLCRPCHNREKAKGLGKYICQRCHLVIDEQPLMFR