DGCR6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2091400
Article Name: DGCR6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2091400
Supplier Catalog Number: orb2091400
Alternative Catalog Number: BYT-ORB2091400-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DGCR6
Conjugation: Biotin
DGCR6 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 25 kDa
NCBI: 005666
UniProt: Q14129
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: REEQRAMDQKIVLELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLL