CDC42BPB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2091403
Article Name: CDC42BPB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2091403
Supplier Catalog Number: orb2091403
Alternative Catalog Number: BYT-ORB2091403-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CDC42BPB
Conjugation: Biotin
Alternative Names: MRCKB
CDC42BPB Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 194kDa
NCBI: 006026
UniProt: Q9Y5S2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GLKLPDFQDSIFEYFNTAPLAHDLTFRTSSASEQETQAPKPEASPSMSVA