NDRG3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2091487
Article Name: NDRG3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2091487
Supplier Catalog Number: orb2091487
Alternative Catalog Number: BYT-ORB2091487-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human NDRG3
Conjugation: Biotin
Alternative Names: FLJ13556
NDRG3 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 40kDa
NCBI: 071922
UniProt: Q9UGV2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RLARSRTHSTSSSLGSGESPFSRSVTSNQSDGTQESCESPDVLDRHQTME