SNX6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2091604
Article Name: SNX6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2091604
Supplier Catalog Number: orb2091604
Alternative Catalog Number: BYT-ORB2091604-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SNX6
Conjugation: Biotin
Alternative Names: TFAF2, MSTP010
SNX6 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 48kDa
NCBI: 689419
UniProt: Q9UNH7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DGVIVSGVKDVDDFFEHERTFLLEYHNRVKDASAKSDRMTRSHKSAADDY