PIGP Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2091613
Article Name: PIGP Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2091613
Supplier Catalog Number: orb2091613
Alternative Catalog Number: BYT-ORB2091613-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human PIGP
Conjugation: Biotin
Alternative Names: DCRC, DSRC, DEE55, DSCR5, PIG-P, DCRC-S, EIEE55
PIGP Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 11kDa
UniProt: P57054
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: NMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLA