BRCC3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2091634
| Article Name: |
BRCC3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2091634 |
| Supplier Catalog Number: |
orb2091634 |
| Alternative Catalog Number: |
BYT-ORB2091634-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of human BRCC3 |
| Conjugation: |
Biotin |
| Alternative Names: |
C6.1A, BRCC36, CXorf53 |
| BRCC3 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
41kDa |
| NCBI: |
001018065 |
| UniProt: |
P46736 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: QERYIERAQQEKEELQQEMAQQSRSLQQAQQQLEEVRQNRQRADEDVEAA |
