NLRX1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2091679
Article Name: NLRX1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2091679
Supplier Catalog Number: orb2091679
Alternative Catalog Number: BYT-ORB2091679-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human NLRX1
Conjugation: Biotin
Alternative Names: NOD5, NOD9, NOD26, DLNB26, CLR11.3
NLRX1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 107kDa
NCBI: 078894
UniProt: Q86UT6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SEYWSVILSEVQRNLNSWDRARVQRHLELLLRDLEDSRGATLNPWRKAQL