DCLK1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2091979
Article Name: DCLK1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2091979
Supplier Catalog Number: orb2091979
Alternative Catalog Number: BYT-ORB2091979-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human DCLK1
Conjugation: Biotin
Alternative Names: CL1, DCLK, CLICK1, DCDC3A, DCAMKL1
DCLK1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 39kDa
NCBI: 001182344
UniProt: O15075
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: IFIACGPEKFRYQDDFLLDESECRVVKSTSYTKIASSSRRSTTKSPGPSR