SYCN Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2092057
| Article Name: |
SYCN Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2092057 |
| Supplier Catalog Number: |
orb2092057 |
| Alternative Catalog Number: |
BYT-ORB2092057-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SYCN |
| Conjugation: |
Biotin |
| Alternative Names: |
SYL, INSSA1 |
| SYCN Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
15kDa |
| NCBI: |
001073937 |
| UniProt: |
Q0VAF6 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: MSPLRPLLLALALASVPCAQGACPASADLKHSDGTRTCAKLYDKSDPYYE |
