GPR35 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Catalog Number:
BYT-ORB2092236
| Article Name: |
GPR35 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2092236 |
| Supplier Catalog Number: |
orb2092236 |
| Alternative Catalog Number: |
BYT-ORB2092236-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR35 |
| Conjugation: |
FITC |
| GPR35 Rabbit Polyclonal Antibody (FITC) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
37kDa |
| NCBI: |
001182310 |
| UniProt: |
Q9HC97 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: HNFNSMAFPLLGFYLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAAR |