GLIPR1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2092242
Article Name: GLIPR1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2092242
Supplier Catalog Number: orb2092242
Alternative Catalog Number: BYT-ORB2092242-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human GLIPR1
Conjugation: FITC
Alternative Names: GLIPR, RTVP1, CRISP7
GLIPR1 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 006842
UniProt: P48060
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWA