TLL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2092261
Article Name: TLL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2092261
Supplier Catalog Number: orb2092261
Alternative Catalog Number: BYT-ORB2092261-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TLL1
Conjugation: Biotin
Alternative Names: TLL, ASD6
TLL1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 115kDa
NCBI: 036596
UniProt: O43897
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DASVQRKGFQATHSTECGGRLKAESKPRDLYSHAQFGDNNYPGQVDCEWL