Iqgap2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2092339
| Article Name: |
Iqgap2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2092339 |
| Supplier Catalog Number: |
orb2092339 |
| Alternative Catalog Number: |
BYT-ORB2092339-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Iqgap2 |
| Conjugation: |
Biotin |
| Alternative Names: |
AI788777, A630053O10, 4933417J23Rik |
| Iqgap2 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
180kDa |
| NCBI: |
081987 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: DNLKRKNSRRSIKLDGKAEPKGTKRVKPVRYTAAKLHDKGVLLGIDDLQT |
