CSF2RA Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2092357
| Article Name: |
CSF2RA Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2092357 |
| Supplier Catalog Number: |
orb2092357 |
| Alternative Catalog Number: |
BYT-ORB2092357-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CSF2RA |
| Conjugation: |
Biotin |
| Alternative Names: |
GMR, CD116, CSF2R, SMDP4, CDw116, CSF2RX, CSF2RY, GMCSFR, CSF2RAX, CSF2RAY, alphaGMR, GMR-alpha, GMCSFR-alpha, GM-CSF-R-alpha |
| CSF2RA Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
31kDa |
| NCBI: |
001155004 |
| UniProt: |
B4DW68 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: VLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIW |
