CD274 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2093788
Article Name: CD274 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2093788
Supplier Catalog Number: orb2093788
Alternative Catalog Number: BYT-ORB2093788-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of CD274
Conjugation: Biotin
Alternative Names: B7-H, B7H1, PDL1, PD-L1, hPD-L1, PDCD1L1, PDCD1LG1
CD274 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 054862
UniProt: Q9NZQ7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: HLVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEE