Mrpl22 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2094424
| Article Name: |
Mrpl22 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2094424 |
| Supplier Catalog Number: |
orb2094424 |
| Alternative Catalog Number: |
BYT-ORB2094424-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Mouse Mrpl22 |
| Conjugation: |
Biotin |
| Alternative Names: |
Rpm, MRP-, HSPC1, L22mt, Rpml25, HSPC158, MRP-L22, MRP-L25, E030011D16Rik |
| Mrpl22 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
24kDa |
| NCBI: |
778166 |
| UniProt: |
Q8BU88 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: MSIDQALAQLEFNDKKGAQIIKEVLLEAQDMAVRDHNVEFRSNLHIAEST |