Mrpl22 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2094424
Article Name: Mrpl22 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2094424
Supplier Catalog Number: orb2094424
Alternative Catalog Number: BYT-ORB2094424-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Mrpl22
Conjugation: Biotin
Alternative Names: Rpm, MRP-, HSPC1, L22mt, Rpml25, HSPC158, MRP-L22, MRP-L25, E030011D16Rik
Mrpl22 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 778166
UniProt: Q8BU88
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MSIDQALAQLEFNDKKGAQIIKEVLLEAQDMAVRDHNVEFRSNLHIAEST