ARL10 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2094562
Article Name: ARL10 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2094562
Supplier Catalog Number: orb2094562
Alternative Catalog Number: BYT-ORB2094562-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARL10
Conjugation: Biotin
Alternative Names: ARL10A
ARL10 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 27 kDa
NCBI: 775935
UniProt: Q8N8L6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MAPRPLGPLVLALGGAAAVLGSVLFILWKTYFGRGRERRWDRGEAWWGAE