Cuedc2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2094712
Article Name: Cuedc2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2094712
Supplier Catalog Number: orb2094712
Alternative Catalog Number: BYT-ORB2094712-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Cuedc2
Conjugation: Biotin
Alternative Names: 3010002G01Rik
Cuedc2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 31kDa
NCBI: 001157762
UniProt: Q9CXX9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: IPRGIIGDMMQKLSVQLSDARNKENLHPQSSCVQGQVPIFPETPRQAEKL