NDUFA6 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2094821
Article Name: NDUFA6 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2094821
Supplier Catalog Number: orb2094821
Alternative Catalog Number: BYT-ORB2094821-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NDUFA6
Conjugation: HRP
Alternative Names: B14, LYRM6, CI-B14, MC1DN33, NADHB14
NDUFA6 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 16kDa
NCBI: 002481
UniProt: P56556
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: VRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDIT