Ndufa3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2094829
Article Name: Ndufa3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2094829
Supplier Catalog Number: orb2094829
Alternative Catalog Number: BYT-ORB2094829-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Ndufa3
Conjugation: Biotin
Alternative Names: 1010001M12Rik, 1700022J01Rik
Ndufa3 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 9kDa
NCBI: 079624
UniProt: Q9CQ91
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ISPYTKYASMINKATPYNYPVPVRDDGNMPDVPSHPQDPLGPSLDWLKNL