Tfap2b Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2096183
Article Name: Tfap2b Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096183
Supplier Catalog Number: orb2096183
Alternative Catalog Number: BYT-ORB2096183-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Tfap2b
Conjugation: HRP
Alternative Names: Tcfap2b
Tfap2b Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 49kDa
NCBI: 001100366
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: HPWGQRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHS