HARS Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2096187
Article Name: HARS Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096187
Supplier Catalog Number: orb2096187
Alternative Catalog Number: BYT-ORB2096187-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HARS
Conjugation: FITC
Alternative Names: HRS, HARS, CMT2W, USH3B
HARS Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 56kDa
NCBI: 002100
UniProt: P12081
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETL