TNFAIP3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2096196
Article Name: TNFAIP3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096196
Supplier Catalog Number: orb2096196
Alternative Catalog Number: BYT-ORB2096196-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human TNFAIP3
Conjugation: FITC
Alternative Names: A20, AISBL, OTUD7C, TNFA1P2
TNFAIP3 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 51kDa
NCBI: 001257436
UniProt: P21580
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QENSEQGRREGHAQNPMEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHE