TNFAIP3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2096198
Article Name: TNFAIP3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096198
Supplier Catalog Number: orb2096198
Alternative Catalog Number: BYT-ORB2096198-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence LGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRP
Conjugation: HRP
Alternative Names: A20, AISBL, OTUD7C, TNFA1P2
TNFAIP3 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 90 kDa
NCBI: 006281
UniProt: P21580
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: LGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRP