TNFAIP3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2096199
Article Name: TNFAIP3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096199
Supplier Catalog Number: orb2096199
Alternative Catalog Number: BYT-ORB2096199-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence LGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRP
Conjugation: FITC
Alternative Names: A20, AISBL, OTUD7C, TNFA1P2
TNFAIP3 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 90 kDa
NCBI: 006281
UniProt: P21580
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRP