RACK1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2096216
Article Name: RACK1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096216
Supplier Catalog Number: orb2096216
Alternative Catalog Number: BYT-ORB2096216-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Gnb2l1
Conjugation: HRP
Alternative Names: p20, Gnb2, p205, GB-li, Gnb2-, Gnb2l1, GB-like, AL033335, Gnb2-rs1
RACK1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 032169
UniProt: P68040
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: HIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIIN