CD70 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2096228
Article Name: CD70 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096228
Supplier Catalog Number: orb2096228
Alternative Catalog Number: BYT-ORB2096228-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CD70
Conjugation: HRP
Alternative Names: CD27L, LPFS3, CD27-L, CD27LG, TNFSF7, TNLG8A
CD70 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 21 kDa
NCBI: 001243
UniProt: P32970
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: RLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP