CD70 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2096230
Article Name: CD70 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096230
Supplier Catalog Number: orb2096230
Alternative Catalog Number: BYT-ORB2096230-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CD70
Conjugation: Biotin
Alternative Names: CD27L, LPFS3, CD27-L, CD27LG, TNFSF7, TNLG8A
CD70 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 21 kDa
NCBI: 001243
UniProt: P32970
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP