ADAM17 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2096232
Article Name: ADAM17 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096232
Supplier Catalog Number: orb2096232
Alternative Catalog Number: BYT-ORB2096232-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ADAM17
Conjugation: FITC
Alternative Names: CSVP, TACE, NISBD, ADAM18, CD156B, NISBD1
ADAM17 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 90kDa
NCBI: 003174
UniProt: P78536
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DGFEKDPFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC