PTGDR Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2096247
Article Name: PTGDR Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096247
Supplier Catalog Number: orb2096247
Alternative Catalog Number: BYT-ORB2096247-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PTGDR
Conjugation: FITC
Alternative Names: DP, AS1, DP1, ASRT1, PTGDR1
PTGDR Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 40kDa
NCBI: 000944
UniProt: Q13258
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FKDVKEKNRTSEEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIF