GABBR2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2096506
Article Name: GABBR2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096506
Supplier Catalog Number: orb2096506
Alternative Catalog Number: BYT-ORB2096506-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GABBR2
Conjugation: Biotin
Alternative Names: HG20, DEE59, GPR51, EIEE59, GPRC3B, NDPLHS, GABABR2, HRIHFB2099
GABBR2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 106kDa
NCBI: 005449
UniProt: O75899
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QFTQNQKKEDSKTSTSVTSVNQASTSRLEGLQSENHRLRMKITELDKDLE