TPR Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2096524
Article Name: TPR Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096524
Supplier Catalog Number: orb2096524
Alternative Catalog Number: BYT-ORB2096524-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TPR
Conjugation: Biotin
TPR Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 267kDa
NCBI: 003283
UniProt: P12270
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SSEAGLEIDSQQEEEPVQASDESDLPSTSQDPPSSSSVDTSSSQPKPFRR