HK1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2096572
Article Name: HK1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096572
Supplier Catalog Number: orb2096572
Alternative Catalog Number: BYT-ORB2096572-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HK1
Conjugation: Biotin
Alternative Names: HK, HKD, HKI, HXK1, RP79, HMSNR, HK1-ta, HK1-tb, HK1-tc, NEDVIBA, hexokinase
HK1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 103kDa
NCBI: 277033
UniProt: P19367
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTR