CD44 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2096593
Article Name: CD44 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096593
Supplier Catalog Number: orb2096593
Alternative Catalog Number: BYT-ORB2096593-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CD44
Conjugation: Biotin
Alternative Names: IN, LHR, MC56, MDU2, MDU3, MIC4, Pgp1, CDW44, CSPG8, HCELL, HUTCH-I, ECMR-III
CD44 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 40kDa
NCBI: 001001391
UniProt: P16070
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSETPDQFMTADETRNLQN